PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_011033-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 302aa    MW: 34006.2 Da    PI: 5.9208
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_011033-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1031.7e-32117173258
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                    dDgy+WrKYGqK++k++++prsYYrCt ++C++kk+vers+edp++++itYeg H h
  NNU_011033-RA 117 DDGYKWRKYGQKSIKNNPNPRSYYRCTNPRCSAKKQVERSSEDPDTLVITYEGLHLH 173
                    8******************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.1E-30111173IPR003657WRKY domain
PROSITE profilePS5081128.231111176IPR003657WRKY domain
SuperFamilySSF1182908.5E-27114173IPR003657WRKY domain
SMARTSM007743.5E-36116175IPR003657WRKY domain
PfamPF031068.6E-26117173IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MERLEHLGVN LSDGLEEELV RELLYDNESP FFILPEKIEP KPCISPEPIR NQLISNVYSG  60
PTIEDIEGAL SSTDRNSESD YHRSMSQARI SILEKGLSKI ENKYTLRIKS CANGLADDGY  120
KWRKYGQKSI KNNPNPRSYY RCTNPRCSAK KQVERSSEDP DTLVITYEGL HLHFAYSHFL  180
PTPSYQAYQP VKKPKKDTPQ IQAHPIQQSH DVLAQESSPT VYPAPPSPFG CEVQQELVEG  240
DVSRQGLLED MVPLKIRNPW NNNNVLSSSC NLPSSPSSSS STLSWSPNYP SFIDVGIISS  300
MM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-211151731674Probable WRKY transcription factor 4
1wj2_A2e-211151731674Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010262546.10.0PREDICTED: probable WRKY transcription factor 49
TrEMBLD7THM02e-88D7THM0_VITVI; Putative uncharacterized protein
STRINGVIT_08s0007g00570.t017e-88(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.15e-47WRKY DNA-binding protein 49